PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK30137.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB
Protein Properties Length: 267aa    MW: 30627.6 Da    PI: 7.5889
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK30137.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.13.5e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ ++k +G g+W++ +r  g+ R++k+c++rw +yl
       KFK30137.1 14 KGAWTKEEDDKLISYIKSHGEGCWRSLPRSAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding574.6e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T eEd+l+++++ +lG++ W++Ia +++ gRt++++k++w+++
       KFK30137.1  67 RGNFTVEEDDLIIKLHSLLGNK-WSLIATRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.7E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.565961IPR017930Myb domain
SMARTSM007171.4E-131363IPR001005SANT/Myb domain
SuperFamilySSF466892.13E-2913108IPR009057Homeodomain-like
PfamPF002492.3E-151461IPR001005SANT/Myb domain
CDDcd001675.98E-101661No hitNo description
PROSITE profilePS5129428.68662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2765116IPR009057Homeodomain-like
SMARTSM007171.0E-1766114IPR001005SANT/Myb domain
PfamPF002491.2E-1667111IPR001005SANT/Myb domain
CDDcd001672.00E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MGRSPCCEKD HTNKGAWTKE EDDKLISYIK SHGEGCWRSL PRSAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TVEEDDLIIK LHSLLGNKWS LIATRLPGRT DNEIKNYWNT HVKRKLLRRG  120
IDPITHRPIN ETKACKDFSE AREEEDSLVK ILSFGPKVEK DQENGLVCKK EIDEDLVGEE  180
RRCLDLNLEL RISPPWQDQV HGREKFHCNA CRFGFGNGKE CRCGDVKCQT DESSSSSYSS  240
SDITSSIGYD FLGLNSRVLD FSPLEMQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006412165.11e-146hypothetical protein EUTSA_v10025926mg
SwissprotO496081e-144MYB32_ARATH; Transcription factor MYB32
TrEMBLA0A087GJT50.0A0A087GJT5_ARAAL; Uncharacterized protein
STRINGscaffold_700628.11e-142(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34990.11e-144myb domain protein 32